PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID HL.SW.v1.0.G026006.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
Family Dof
Protein Properties Length: 337aa    MW: 36685.9 Da    PI: 7.0764
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
HL.SW.v1.0.G026006.1genomeHOPBASEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.14.5e-393898262
                zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                          +++alkcprCds ntkfCyynny+lsqPr+fCk+CrryWtkGG lrnvPvGgg+rk k+s+
  HL.SW.v1.0.G026006.1 38 QQQALKCPRCDSLNTKFCYYNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRKTKRSK 98
                          6899*****************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-262991IPR003851Zinc finger, Dof-type
PfamPF027013.4E-334096IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.6744296IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104480IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MQDVHSIGDG GRFFAGSGGG GAAGDRRLRP HHNHNQTQQQ ALKCPRCDSL NTKFCYYNNY  60
NLSQPRHFCK NCRRYWTKGG VLRNVPVGGG CRKTKRSKQK SSSASATTVP EPRQPSQDRK  120
SNSHSSSESS SLTATNTNAA TEAVSAPSTS FGSNLLNVNQ ESKFFVSQST NPSFEAPALI  180
EQSGSDWGIF SDIGSFTNLI TSSSNGGGAM AAFEYNSISD ISISPFRLNQ QGQDHHHQAP  240
QSQTWHQQNT KTMNVLTDQD QVKVQEITGG LLDETSQADL CVLQDRSNGG VFGSLGDWQS  300
CGDQGLFDLP NSVDQTYWSQ SQSQWTDQDH TSLYLP*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00570DAPTransfer from AT5G60850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010101639.11e-137Dof zinc finger protein
TrEMBLW9RP281e-137W9RP28_9R
STRINGVIT_17s0000g04850.t013e-86(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59983050
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.18e-35OBF binding protein 4